>1qcy_A mol:protein length:193  I-DOMAIN OF INTEGRIN ALPHA1BETA1
TQLDIVIVLDGSNSIYPWDSVTAFLNDLLKRMDIGPKQTQVGIVQYGENVTHEFNLNKY
SSTEEVLVAAKKIVQRGGAQTMTALGTDTARKEAFTEARGARRGVKKVMVIVTDGESHD
NHRLKKVIQDCEDENIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDE
LALVTIVKTLGERIFA