>1qdu_F mol:protein length:88  CASPASE-8 BETA-CHAIN
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNY
EVSNKDDKKNMGKQMPQPTFTLRKKLVFP