>1qn7_F mol:na length:14  DNA (5'-D(*TP*GP*CP*CP*CP*TP*TP*AP*TP*AP*TP*AP*GP*C)-3')
TGCCCTTATATAGC
>1qn7_B mol:protein length:200  TRANSCRIPTION INITIATION FACTOR TFIID-1
MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAA
VIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNI
VGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKM
RDETYKAFENIYPVLSEFRKIQQ
>1qn7_A mol:protein length:200  TRANSCRIPTION INITIATION FACTOR TFIID-1
MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAA
VIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNI
VGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKM
RDETYKAFENIYPVLSEFRKIQQ
>1qn7_C mol:na length:14  DNA (5'-D(*GP*CP*TP*AP*TP*AP*TP*AP*AP*GP*GP*GP*CP*A)-3')
GCTATATAAGGGCA
>1qn7_E mol:na length:14  DNA (5'-D(*GP*CP*TP*AP*TP*AP*TP*AP*AP*GP*GP*GP*CP*A)-3')
GCTATATAAGGGCA
>1qn7_D mol:na length:14  DNA (5'-D(*TP*GP*CP*CP*CP*TP*TP*AP*TP*AP*TP*AP*GP*C)-3')
TGCCCTTATATAGC
>1qn7_F mol:na length:14  DNA (5'-D(*TP*GP*CP*CP*CP*TP*TP*AP*TP*AP*TP*AP*GP*C)-3')
TGCCCTTATATAGC