>1qnc_B mol:protein length:200  TRANSCRIPTION INITIATION FACTOR TFIID-1
MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAA
VIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNI
VGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKM
RDETYKAFENIYPVLSEFRKIQQ