>1qsr_A mol:protein length:162  TGCN5 HISTONE ACETYL TRANSFERASE
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVI
GGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAI
GYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR