>1qva_A mol:protein length:223  INITIATION FACTOR 4A
SEGITDIEESQIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDI
KVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSS
GFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV