>1r9f_C mol:na length:21  5'-R(*UP*CP*GP*AP*AP*GP*UP*AP*UP*UP*CP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'
UCGAAGUAUUCCGCGUACGUU
>1r9f_A mol:protein length:136  Core protein P19
GSHMTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEA
SLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRS
KQEMLQMAPIEVESNVSR
>1r9f_C mol:na length:21  5'-R(*UP*CP*GP*AP*AP*GP*UP*AP*UP*UP*CP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'
UCGAAGUAUUCCGCGUACGUU
>1r9f_B mol:na length:21  5'-R(*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*AP*UP*U)-3'
CGUACGCGGAAUACUUCGAUU