>1rb4_B mol:protein length:33  General control protein GCN4
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER