>1rb6_C mol:protein length:34  General control protein GCN4
XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER