>1rc5_B mol:protein length:154  Ribonuclease III
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQY
SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVY
IDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
>1rc5_D mol:protein length:154  Ribonuclease III
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQY
SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVY
IDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
>1rc5_D mol:protein length:154  Ribonuclease III
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQY
SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVY
IDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
>1rc5_A mol:protein length:154  Ribonuclease III
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQY
SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVY
IDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH
>1rc5_C mol:protein length:154  Ribonuclease III
GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQY
SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVY
IDSGRDANFTRELFYKLFKEDILSAIKEGRHHHHHH