>1rpu_C mol:na length:21  5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'
CGUACGCGUCACGCGUACGUU
>1rpu_D mol:na length:21  5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'
CGUACGCGUCACGCGUACGUU
>1rpu_D mol:na length:21  5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP*GP*UP*U)-3'
CGUACGCGUCACGCGUACGUU
>1rpu_B mol:protein length:172  19 kDa protein
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGF
KESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRG
VSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEGIETFKKESE
>1rpu_A mol:protein length:172  19 kDa protein
MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGF
KESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRG
VSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEGIETFKKESE