>1ruo_B mol:protein length:209  PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP))
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSA
QMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVG
CSRFTVGRILKMLEDQNLISAHGKTIVVYGTR