>1rzi_B mol:protein length:230  Fab 47e heavy chain
QVQLLQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPVFGSAN
YAQKFQGRVTITADEATSTTYMELSSLRSEDTAVYFCAKGGEDGDYLSDPFYYNHGMDV
WGQGTTVTVASASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK