>1s3c_A mol:protein length:141  Arsenate reductase
MSNITIYHNPASGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALL
RKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQD
AQKGAFTKEDGEKVVDEAGKRLK