>1s72_L mol:protein length:165  50S ribosomal protein L15P
MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQ
EEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHE
LTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE