>1s89_E mol:protein length:152  Methylglyoxal synthase
MELTTRTLPARKHIALVAHDHCKQMLMSWVERHQPLLEQHVLYATGTTGNLISRATGMN
VNAMLSGPMGGDQQVGALISEGKIDVLIFFWDPLNAVPNDPDVKALLRLATVWNIPVAT
NVATADFIIQSPHFNDAVDILIPDYQRYLADRLK