>1sfu_B mol:protein length:75  34L protein
MDLLSCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTV
KMVPSNPPKWFKNYNC