>1shc_B mol:protein length:12  TRKA RECEPTOR PHOSPHOPEPTIDE
HIIENPQYFSDA
>1shc_B mol:protein length:12  TRKA RECEPTOR PHOSPHOPEPTIDE
HIIENPQYFSDA
>1shc_A mol:protein length:195  SHC
GSHMGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDF
NTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQD
VISTIGQAFELRFKQYLR