>1si4_B mol:protein length:146  Hemoglobin delta chain
VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNF
GKEFTPQMQAAYQKVVAGVANALAHKYH