>1sn8_B mol:protein length:96  Ribonuclease E
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRP
NIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
>1sn8_B mol:protein length:96  Ribonuclease E
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRP
NIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS
>1sn8_A mol:protein length:96  Ribonuclease E
GSHMLEQKKANIYKGKITRIEPSLEAAFVDYGAERHGFLPLKEIAREYFPANYSAHGRP
NIKDVLREGQEVIVQIDKEERGNKGAALTTFISLAGS