>1ssf_A mol:protein length:156  Transformation related protein 53 binding protein 1
GDSSSSGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLC
DPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGN
RLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSN