>1sy6_A mol:protein length:204  T-cell surface glycoprotein CD3 gamma/epsilon chain
MQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKD
PRGMYQCKGSQNKSKPLQVYYRMGSADDAKKDAAKKDDAKKDDAKKDGSDGNEEMGGIT
QTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELE
QSGYYVCYPRGSKPEDANFYLYLRARV