>1t0p_A mol:protein length:175  Integrin alpha-L
MGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSD
YVKWKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATD
SGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVCILDTFECLKDLFTE
>1t0p_B mol:protein length:86  Intercellular adhesion molecule-3
QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNV
TGNSRILCSVYCNGSQITGSSNITVYG
>1t0p_B mol:protein length:86  Intercellular adhesion molecule-3
QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNV
TGNSRILCSVYCNGSQITGSSNITVYG