>1tf6_A mol:protein length:190  PROTEIN (TRANSCRIPTION FACTOR IIIA)
MGEKALPVVYKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKK
HNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTW
TLYLKHVAECHQD
>1tf6_C mol:na length:31  DNA (5'-D(*TP*GP*GP*TP*CP*TP*CP*CP*CP*AP*TP*CP*CP*AP*GP*GP*T P*AP*CP*TP*AP*AP* CP*CP*AP*GP*GP*CP*CP*CP*G)-3')
TGGTCTCCCATCCAGGTACTAACCAGGCCCG
>1tf6_D mol:protein length:190  PROTEIN (TRANSCRIPTION FACTOR IIIA)
MGEKALPVVYKRYICSFADCGAAYNKNWKLQAHLCKHTGEKPFPCKEEGCEKGFTSLHH
LTRHSLTHTGEKNFTCDSDGCDLRFTTKANMKKHFNRFHNIKICVYVCHFENCGKAFKK
HNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTW
TLYLKHVAECHQD
>1tf6_F mol:na length:31  DNA (5'-D(*TP*GP*GP*TP*CP*TP*CP*CP*CP*AP*TP*CP*CP*AP*GP*GP*T P*AP*CP*TP*AP*AP* CP*CP*AP*GP*GP*CP*CP*CP*G)-3')
TGGTCTCCCATCCAGGTACTAACCAGGCCCG
>1tf6_B mol:na length:31  DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C P*CP*TP*GP*GP*AP* TP*GP*GP*GP*AP*GP*AP*CP*C)-3')
ACGGGCCTGGTTAGTACCTGGATGGGAGACC
>1tf6_F mol:na length:31  DNA (5'-D(*TP*GP*GP*TP*CP*TP*CP*CP*CP*AP*TP*CP*CP*AP*GP*GP*T P*AP*CP*TP*AP*AP* CP*CP*AP*GP*GP*CP*CP*CP*G)-3')
TGGTCTCCCATCCAGGTACTAACCAGGCCCG
>1tf6_E mol:na length:31  DNA (5'-D(*AP*CP*GP*GP*GP*CP*CP*TP*GP*GP*TP*TP*AP*GP*TP*AP*C P*CP*TP*GP*GP*AP* TP*GP*GP*GP*AP*GP*AP*CP*C)-3')
ACGGGCCTGGTTAGTACCTGGATGGGAGACC