>1tho_A mol:protein length:109  THIOREDOXIN
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGRPCKMIAPILDEIADEYQGKLTVAKL
NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA