>1tmz_A mol:protein length:32  TMZIP
MDAIKKKMQMLKLDNYHLENEVARLKKLVGER
>1tmz_B mol:protein length:32  TMZIP
MDAIKKKMQMLKLDNYHLENEVARLKKLVGER
>1tmz_B mol:protein length:32  TMZIP
MDAIKKKMQMLKLDNYHLENEVARLKKLVGER