>1tmz_A mol:protein length:32  TMZIP
MDAIKKKMQMLKLDNYHLENEVARLKKLVGER