>1tnf_C mol:protein length:157  TUMOR NECROSIS FACTOR-ALPHA
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPI
YLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
>1tnf_A mol:protein length:157  TUMOR NECROSIS FACTOR-ALPHA
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPI
YLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
>1tnf_C mol:protein length:157  TUMOR NECROSIS FACTOR-ALPHA
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPI
YLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL
>1tnf_B mol:protein length:157  TUMOR NECROSIS FACTOR-ALPHA
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPI
YLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL