>1tnf_A mol:protein length:157  TUMOR NECROSIS FACTOR-ALPHA
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIY
SQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPI
YLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL