>1ub5_A mol:protein length:209  antibody 19G2, alpha chain
EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYY
PDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTT
PPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMS
SSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
>1ub5_B mol:protein length:214  antibody 19G2, beta chain
DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNL
ASGVPNRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
>1ub5_H mol:protein length:209  antibody 19G2, alpha chain
EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYY
PDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTT
PPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMS
SSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE
>1ub5_B mol:protein length:214  antibody 19G2, beta chain
DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNL
ASGVPNRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF
>1ub5_L mol:protein length:214  antibody 19G2, beta chain
DIVMTQAAFSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNL
ASGVPNRFSSSGSGTDFTLRISRVEAEDVGVYYCAQNLELPPTFGGGTKLEIKRADAAP
TVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST
YSMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF