>1ub5_A mol:protein length:209  antibody 19G2, alpha chain
EVKLLESGGGLVKPGGSLKLSCTASGITFSRYIMSWVRQIPEKRLEWVASISSGGITYY
PDSVAGRFTISRDNVRNILYLQMSSLRSEDTALYYCARGQGRPYWGQGTLVTVSSAKTT
PPSVYPAAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGGSSVHTFPALLQSGLYTMS
SSVTVPSSTWPSTVTCSVAHPASSTTVDKKLE