>1ub6_B mol:protein length:213  antibody 19G2, beta chain
AALTQSPVSNPVTLGTSASISCRSTKSLLHSNGITYLYWYLQKPGQSPQLLIYQMSNLA
SGVPNRFSSSGSGTDFTLRINTVEAEDVGVYYCAQNLELPPTFGAGTKLELKRADAAPT
VSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTY
SMSSTLTLTKDEYERHNGYTCEATHKTSTSPIVKSF