>1uez_A mol:protein length:101  KIAA1526 Protein
GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQI
LRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRISGPSSG
>1uez_A mol:protein length:101  KIAA1526 Protein
GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQI
LRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRISGPSSG