>1un1_B mol:protein length:278  XYLOGLUCAN ENDOTRANSGLYCOSYLASE
XETAAFAALRKPVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLF
GHFSMQMKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGD
REQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNCKDLGVKFPFNQPMKIYS
SLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQ
DLDAFQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI