>1vq4_V mol:protein length:71  50S ribosomal protein L29P
MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKT
IQGEEGDLQENE