>1vq7_2 mol:protein length:50  50S ribosomal protein L39e
MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE