>1vq7_I mol:protein length:162  50S RIBOSOMAL PROTEIN L11P
MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDD
GSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLT
NAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA