>1vq7_Z mol:protein length:83  50S ribosomal protein L37Ae
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGS
YKPETPGGKTVRRSIRAALSEDEE