>1vqm_P mol:protein length:149  50S ribosomal protein L19E
MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNS
RGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSS
QYRDLYDKAGGGEFDSVADLERYIDANHGDA