>1vqn_J mol:protein length:145  50S ribosomal protein L13P
MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEK
RVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDG
TSLDRLSNIKFVTLGEISETLGANKTW