>1vqp_Q mol:protein length:96  50S ribosomal protein L21e
MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDG
QTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE