>1vzj_B mol:protein length:40  ACETYLCHOLINESTERASE
DTLDEAERQWKAEFHRWSSYMVHWKNQFDHYSKQDRCSDL