>1wh6_A mol:protein length:101  Homeobox protein Cux-2
GSSGSSGQYELYMYREVDTLELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRP
KPWSKLTQKGREPFIRMQLWLSDQLGQAVGQQPGASSGPSSG