>1x2w_A mol:protein length:129  Coagulation factor IX/X-binding protein A chain
DCPSGWSSYEGHCYKPFKLYKTWDDAERFCTEQAKGGHLVSIESAGEADFVAQLVTENI
QNTKSYVWIGLRVQGKEKQCSSEWSDGSSVSYENWIEAESKTCLGLEKETGFRKWVNIY
CGQQNPFVCEA