>1x5z_A mol:protein length:115  Receptor-type tyrosine-protein phosphatase delta
GSSGSSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHG
EEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSSGPSSG
>1x5z_A mol:protein length:115  Receptor-type tyrosine-protein phosphatase delta
GSSGSSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIANYELVYKDGEHG
EEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQSSGPSSG