>1x9l_A mol:protein length:149  CuI-DR1885
MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPI
KLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPL
KVGETVNITLKATDGRTLNVAATVKKNIEGR
>1x9l_A mol:protein length:149  CuI-DR1885
MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPI
KLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPL
KVGETVNITLKATDGRTLNVAATVKKNIEGR