>1xc5_A mol:protein length:71  Nuclear receptor corepressor 2
GSMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVL
YYYLTKKNENYK