>1xdm_C mol:protein length:365  Fructose-bisphosphate aldolase B
GSAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQ
FREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLA
GTNKETTIQGLDGLSERCAQYKKDGVDFGKWRPVLRIADQCPSSLAIQENANALARYAS
ICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVT
AGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPK
PWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAAS
TQSLFTACYTY