>1xk4_E mol:protein length:93  Calgranulin A
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETESPQYIRKKGADVWFKELD
INTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE