>1xtq_A mol:protein length:177  GTP-binding protein Rheb
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLV
DTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVG
NKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKLEHHHHHH